Amyloid-Degrading Ability of Nattokinase from Bacillus subtilis Natto



Дата20.08.2016
Размер192.56 Kb.




Amyloid-Degrading Ability of Nattokinase from Bacillus subtilis Natto

Ruei-Lin Hsu, Kung-Ta Lee, Jung-Hao Wang, Lily Y.-L. Lee, and Rita P.-Y. Chen



J. Agric. Food Chem., 2009, 57 (2), 503-508» DOI: 10.1021/jf803072r • Publication Date (Web): 31

December 2008 Downloaded from http://pubs.acs.org on February 24, 2009

Natto натокиназа амилоидни фибри



Повече за тази статия
Допълнителни източници и подробности за тази статия има в нейната HTML версия:


  • Подкрепяща информация

  • Достъп до фигури с висока резолюция

  • Линкове към статии и материали, свързани с тази статия

  • Разрешение за репродуциране на фигури и/или текстове от тази статия






Способност на натокиназата от



Bacillus subtilis Natto да разгражда амилоид
Ruei-Lin Hsu,†,‡ Kung-Ta Lee,§ Jung-Hao Wang,§ Lily Y.-L. Lee, and

Rita P.-Y. Chen, ,†,‡


Institute of Biological Chemistry, Academia Sinica, Taipei 115, Taiwan, R. O. C., Institute of

Biochemical Sciences, National Taiwan University, Taipei 106, Taiwan, R. O. C., and Department of



Biochemical Science and Technology, National Taiwan University, Taipei 106, Taiwan, R. O. C.
Повече от 20 не сродни протеини могат да образуват in vivo амилоидни фибри, които са свързани с различни заболявания като болестта на Алцхаймер, прионовата болест и системната амилоидоза. Амилоидните фибри са подреден протеинов агрегат с ламеларна кръстосана-β структура. Усилването на амилоидното прочистване е една от целите на терапията на тези свързани с амилоида заболявания. Въпреки, че има спор, дали токсичността се дължи на амилоидите или на техните прекурсори, проучванията върху разпада на амилоидите могат да помогнат за предотвратяване или постигане на облекчение при тези болести. В това проучване ние изпитахме амилоид разграждащата способност на натокиназата, която е фибринолитична субтилизиноподобна серинова протеаза и определихме оптималните условия за хидролиза на амилоида. Такава способност имат също протеиназа К и субтилизин Carlsberg, но не и трипсинът или плазминът.
КЛЮЧОВИ ДУМИ: Nattokinase; amyloid; natto; subtilisin NAT; amyloid degradation; fibril; amyloidosis


ВЪВЕДЕНИЕ
Ферментиралата храна “natto”, приготвена от сварени соеви зърна, се употребява в Азия от над 1000 години. Микробът, осъществяващ ферментацията е изолиран от “natto”. Той е Gram-положителна бактерия, образуваща ендоспори и наречена Bacillus subtilis natto (наричан по-рано Bacillus natto) (1). Натокиназата (наричана по-рано Subtilisin NAT) (2) е екстрацелуларен ензим, секретиран от B. subtilis natto (3), принадлежащ към семейството на алкалните серинови протеази, чийто каталитичен център съдържа три остатъка, Asp-32, His-64 и Ser-221 (4). Той има молекулна маса 27,7 kDa и изоелектрична точка 8,7 (5). Натокиназата се състои от 275 аминокиселини и генната й последователност е хомоложна на тази на други членове на субтилизиновото семейство (99,5% хомоложност със субтилизин E, 86% със субтилизин BPN’ и 72% със субтилизин Carlsberg) (6). Тя не само разгражда фибрина в тромбите (7), но разцепва и инхибитора тип І на плазминогенния активатор (7, 8). Натокиназата има по-голяма тромболитична активност от естествената тромболитична протеаза в кръвта - плазмина (5, 7, 9). Тя увеличава продукцията на плазмин от плазминоген, което се дължи на въздействието й върху плазминогенния активатор. Тези наблюдения заедно с факта, че след приемане през устата тя може да се абсорбира от чревния тракт (10, 11) и да индуцира фибринолиза (11), прави от натокиназата потенциално средство за разтваряне на тромбите при лечението на сърдечносъдовата болест. Добавянето на “natto” към диетата потиска

* Автор за кореспонденция: Rita P.-Y.Chen, Institute of Biological Chemistry, Academia Sinica, No 128, Sec2, Academia Rd, Nankang, Taipei, 115, Taiwan. Tel: +886-2-2785-5696. Fax: +886-2-2788-9759. E-mail: pyc@gate.sinica.edu.tw.

† Academia Sinica.

‡ Institute of Biochemical Sciences, National Taiwan University.

§ Department of Biochemical Science and Technology, National Taiwan University.


уплътняването на артериалната интима и води до лизиране на тромбите в стената, възникващи след нараняване на ендотела (12). Други агенти с тромболитично действие като урокиназата и стрептокиназата са скъпи и неустойчиви в чревния тракт(13). Ето защо представлява интерес пероралното приложение на натокиназата за фибринолитична терапия на тромбозата и предотвратяване на атеросклерозата. Понастоящем натокиназата се използва като хранителна добавка за подобряване на телесното кръвообращение (3, 11, 12).

Въпреки проведените много проучвания върху натокиназата, няма проявен интерес дали тя може да разгражда амилоидите, които са неразтворими и устойчиви на действието на протеази. Ние изпитахме нейната способност да разгражда амилоидните фибри, образувани от три различни протеини и пептиди. Първата проба бе от Aβ40 фибри. Амилоидните образования под формата на плаки са една от патологичните характеристика на болестта на Алцхаймер, Aβ40 е един от главните продукти от разпада на човешкия протеинов прекурсор на амилоида и основен компонент на амилоидните плаки. Втората проба беше от инсулинови фибри, тъй като многократното инжектиране на инсулин при диабетиците може да причини амилоидоза на местата на инжекциите (14). Третата проба беше от фибри на прионов пептид, тъй като прионът е причинителят на прионовите болести. За да получим амилоидни фибри, ние синтезирахме прионов пептид, имащ последователността на човешкия прион (108-144), тъй като предишни наблюдения бяха показали, че той е най-вероятно сегментът, от който се формира амилоидната структура (15, 16). Човешкият прионов протеин има на позиция 129 или Met, или Val. Ние избрахме последователността, съдържаща Val, тъй като получените амилоидни фибри дават по-силен флуоресцентен сигнал с тест агента тиофлавин T (ThT).









Фигура 1. 15 % SDS-PAGE на пречистена натокиназа, посочена от стрелката.
МАТЕРИАЛИ И МЕТОДИ
Продуциране и пречистване на натокиназата. Изолирахме Bacillus subtilis natto от купешки продукт и го съхранявахме на наклонен NB при 400C (17).

Продуцирането на натокиназа бе извършено в 7-L ферментор (Bioflo 110 Modular Benchtop Fermentor, New Brunswick Scientific, NJ) по метода, описан в наше предишно съобщение (18). Работното количество бе 5 литра 5% (w/v) соево мляко (250 грама соеви зърна на прах в 5 литра H2O), скоростта на аериране бе 1.0 обем за обем за минута, скоростта на разбъркване 800 rpm, а ферментацията протичаше при 370C. Всички следващи стъпки се извършиха при 400C. След 28 часа получихме супернатант чрез центрофугиране на

12 000g и го концентрирахме върху мембрана Amicon Ultra с 10 kDa катоф. Концентрираният ензимен разтвор бе приложен върху гел филтрираща колона (2.6 Х 60 cm), покрита с 320 mL HiPrep 26/60 Sephacryl S-100 високо резолюционен гел (Amersham Biosci.), имащ мобилна фаза от 50 mM натриев фосфат и 150 mM NaCl, pH 7,0 и дебит 0,5 mL/min. Взети бяха фракции от по един милилитър и от тези, показващи натокиназна активност и единствен бенд върху 15% SDS-PAGE, бе направен пул. Натокиназната активност бе определена чрез хромогенен метод, като за субстрат бе използван S2251 (H-D-Val-Leu-Lys-pNA; Sigma) (19).

Пептиден синтез. Пептидът Aβ40 (DAEFRHDSG YEV

HHQKLVFFAEDVGSNKGAIIGLMVGGVV) и последова- телността 108-144 на човешкия прионов пептид с Val в остатък 129 (съкратено huPrP) (Ac-NMKHMAG

AAAAGAVVGGLGGYVLGSAMSRPIIHFGSD-NH2) бяха синтезирани по Fmoc полиамидния метод върху PS3 пептиден синтезатор (Rainin). Завършващият с N край на пептида huPrP бе ацетилиран, а краят, завършващ с C бе амидиран, за да се уподоби конфигурацията на целия протеин. Смола, натоварена с Fmoc-Val-Wang (заместване 0,47 mmol/g) бе закупена от Anaspec Inc. и използвана при синтеза на Aβ40, а за синтеза на huPrP бе закупена смола Rink Amide AM (заместване 0,74 mmol/g) от Novabiochem. Fmoc аминокиселинни деривати (0,4 mmol) бяха свързани с 0.1 mmol смола, при което бяха използвани 0,4 mmol benzotriazole-1-yl-oxy-tris-pyrrolidino-phosphonium hexa флуорофосфати в диметилформамид (DMF), съдържащ 4,45% (v/v) N-метилморфолин. Ацетилирането на края на huPrP, завършващ на N, бе извършено с използване на 0,4 mmol оцетен анхидрид вместо аминокиселинен дериват.


Разцепването на Fmoc бе извършено с 20% (v/v) пиперидин в DMF. Пептидите бяха отцепени от смолата посредством разбъркване на стайна температура в продължение на 1-2 часа със смес от 9.4 mL трифлуорооцетна киселина, 0,1 mL триизопропилсилан, 0,25 mL вода и 0,25 mL етандитиол и преципитирани чрез центрофугиране с три обема леденостуден метил t-бутилов етер на 2000g за 10 минути на 40C. След това промихме пелетите още два пъти с метил t-бутилов етер и ги изсушихме във вакуум. Пречистихме получения бял прах чрез обратнофазова HPLC, като използвахме колона Vydac C18 (10 mm х 250 mm) и ацетонитрил водни смеси, съдържащи 0.1% трифлуорооцетна киселина (v/v). Крайните продукти бяха анализирани чрез матрикс асистирана лазерна десорбционна йонизираща

(MALDI) мас спектрометрия. Фракциите, съдържащи желания продукт, бяха лиофилизирани и съхранявани на

-200C.

Приготвяне на амилоидните фибри. За образуване на Aβ40 фибри бе приготвен 500 μM изходен разтвор на Aβ40 в 75% трифлуороетанол. Пептидната концентрация бе определена количествено чрез абсорбция на 275 nm. За да се образуват фибри, изходният разтвор бе разреден до 25 μM в 20 mM натриевофосфатен буфер, 150 mM KCl, pH 7 и инкубиран на 250C за около две седмици (20). Фибри huPrP бяха приготвени чрез разтваряне на пептид huPrP в 20 mM NaOAc, 140 mM NaCl, pH 3,7 до крайна концентрация от 50 μM и инкубиране на разтвора на 250C за около една седмица (15, 16). За да се получат инсулинови фибри, бе разтворен говежди инсулин (Sigma) в HCl (pH 2,1) в концентрация от 2,5 mg/mL и инкубиран на 600C за около два дни (21, 22). Образуването на фибри бе установявано чрез появата на отрицателна елиптичност на 218 nm при използване на кръгово дихроизмена спектроскопия или флуоресциране от свързването на ThT при използване на флуоресцентна спектроскопия.

Кръгово дихроизмена (CD) спектроскопия. Пробата беше поставена в 1-mm кварцова камерка и на CD спектрометър J-715 (JASCO, Japan) се регистрираше CD спектъра между 200 and 250 nm. Ширината на пропускане бе нагласена на 2 nm, а резолюцията беше 0.1 nm. На всяка проба бяха направени средно по сканирания.

Тиофлавин T байндинг тест. ThT байндинг тестът измерва промяната в интензивността на флуоресценцията на ThT при свързването му с амилоидните фибри. Този метод се използва нашироко за установяване наличието на амилоидни фибри. Бе приготвен изходен разтвор от 5 mM ThT (Sigma) чрез разтваряне на 2 mg от боята в 1,25 mL от 140 mM NaCl, 100 mM фосфатен буфер, pH 8,5, който бе прекаран през 0,22 μm милипоров филтър. Пресният работен разтвор се приготвяше чрез довеждане на крайната концентрация на боята до 200 μM. 30 μL от пробата се смесваха с 30 μL от 200 μM ThT разтвор на боята за 1 минута на стайна температура, след което се измерваше флуоресцентното излъчване между

460 и 600 nm в правоъгълна кювета с дължина на пътя 3 mm, поставена на спектрофлуорометър FP-750 (JASCO, Japan) с възбуждане на 442 nm.



Протеазни разтвори. Изходните разтвори на всички протеази (с изключение на натокиназата от Sigma), използвани в това проучване имаха концентрация 49 μM, която бе количествено определена с аналитичния тест на Bradford (Bio-Rad). Протеазните разтвори бяха изготвени в различни буфери съобразно инструкциите на производителя Натокиназата и субтилизин Carlsberg бяха разтворени в 50 mM фосфатен буфер, съдържащ 150 mM NaCl, pH 7, протеиназа К бе разтворена в 10 mM Tris-HCl буфер, pH 7, трипсинът бе разтворен в 1 mM HCl, а човешкият плазмин – в дестилирана вода.

Разграждане на различните видове амилоидни фибри от натокиназата. Приготвените Aβ40, huPrP и инсулинови фибри бяха събрани чрез центрофугиране на 14 000g за 20 мин на стайна температура и суспендирани в





Фигура 2. CD спектри на Aβ40 фибри (A), huPrP фибри (B) и инсулинови фибри (C) преди и след смилане с натокиназа на 400С, pH 7. Черната линия е на спектъра веднага след добавянето на ензима. Спектрите на пробите, разградени за 1 или 48 часа, са показани с червени, респективно зелени линии.


Фигура 3. Флуоресцентен спектър на излъчване на Aβ40 фибри (A), huPrP фибри (B) и инсулинови фибри (C) преди и след смилане с натокиназа на 400С, pH 7, при прилагане на ThT байндинг тест. Черната линия е на спектъра веднага след добавянето на ензима. Спектрите на пробите, разградени за 1 или 48 часа, са показани с червени, респективно зелени линии.

50 mM фосфатен буфер, съдържащ 150 mM NaCl, pH 7. За да получим по-хомогенни фибри, преди използването им инкубирахме разтворите в ултразвукова баня за 10 минути. За извършване на ензимната реакция 1 μL разтвор на натокиназа бе смесван с 179 μL от всеки вид разтвор на фибри (крайна концентрация на натокиназата 0,27 μM) и сместа се инкубираше на 400C за 1 час. Смилането на фибрите се установяваше с CD спектроскопия и ThT байндинг тест.

Въздействие на температурата и pH върху активността на натокиназата за разлагане на амилоида. В този експеримент като субстрат за ензимната реакция бяха използвани само инсулинови фибри, тъй като бяха необходими по-големи количества фибри (инсулинът се продава, а за образуването на фибри са необходими само 2 дни). Ефектът на температурата върху натокиназната активност беше измерван чрез смилането при различни температури от 30 до 600C при pH 7, като разграждането се мониторираше чрез ThT байндинг тест. За изучаване ефекта на pH върху натокиназната активност инсулиновите фибри бяха суспендирани в следните буфери: 50 mM NaOAc и 150 mM NaCl (pH 5), 50 mM фосфат и 150 mM NaCl (pH 6 and 7), 50 mM Tris-HCl и 150 mM NaCl (pH 8 и 9) и 50 mM глицин-NaOH и 150 mM NaCl (pH 10). Реакцията се правеше на 400C. Натокиназната активност се измерваше чрез

CD спектроскопия, тъй като ThT байндинг тестът е



чувствителен към рН. Концентрацията на използваната натокиназа бе 0,27 μM.

Сравняване на способността на различните протеази за разграждане на Aβ40 фибри. Ензимната реакция бе проведена на 370C, при pH 7 за 1 час с натокиназа, протеиназа К, субтилизин Carlsberg, трипсин или плазмин. Реакционната смес се състоеше от 1 μL протеазен изходен разтвор (49 μM) и 179 μL разтвор на Aβ40 фибри (крайна протеазна концентрация 0,27 μM). На всеки 15 минути от сместа се отделяха по 30 μL за тестване с ThT байндинг тест.

Измерване на скоростта на разграждане на Aβ40 фибрите от натокиназата. Концентрацията на пептида Aβ40 във фибрите бе определяна чрез изваждане от общата концентрация на Aβ40 на концентрацията на пептида Aβ40, намиращ се в супернатанта след центрофугиране. Фибрите бяха суспендирани в 50 mM фосфатен буфер, съдържащ 150 mM NaCl, pH 7,4. Натокиназата бе добавяна към разтвора на фибрите в различни ензимни концентрации, след което сместа се инкубираше на 370C. След различно време на инкубиране се измерваше количеството на останалите фибри чрез ThT байндинг тест. Скоростта на разпадане на фибрите се изчисляваше от времето, необходимо за разграждане на фибрите.
РЕЗУЛТАТИ

Разграждане на амилоидните фибри от натокиназата. Натокиназата беше изчистена от течната култура чрез гел филтрационна хроматография. Фракциите, съдържащи натокиназа бяха идентифицирани с теста за въздействие,




време на смилане (часове)

Фигура 4. Разграждане на инсулинови фибри чрез натокиназа при различни pH. Смилането бе проведено при 400С и мониторирано чрез CD спектроскопия.(A) Време за разграждане, мониторирано чрез измерване на останалите амилоидни фибри. (B) Процент на амилоиден разпад при различни pH, изчислен при използване на данните от едночасово смилане. 100% бе дефинирано като CD елиптичност на 218 nm от пробата преди третирането й. Стойностите са средната ±SEM за резултатите от два експеримента.
след което бяха тествани за наличие на 27,7 kDa банд на SDS-PAGE. Бандът бе характеризиран чрез анализ на N-терминалната последователност. Фракциите, показващи чист протеин, бяха пулирани и лиофилизирани (Фигура 1). За да определим дали натокиназата разгражда амилоида, използвахме Aβ40 фибри, образувани от синтетичен Aβ40 пептид, huPrP фибри, образувани от синтетичен човешки прионов пептид (съдържащ аминокиселини 108-144 на човешки прионов протеин с валин в остатък 129) и инсулинови фибри, образувани от пречистен говежди инсулин. При 400С и pH 7, натокиназата разгражда и трите вида фибри, което се вижда от намаляването на амплитудата на негативната елиптичност на 218 nm в CD спектрите след смилането, включително загубата на β-листната структура (Фигура 2). Подобни резултати бяха получени при използване на ThT байндинг тест, при който намаляването на интензивността на флуоресценцията на 487 nm показва загуба на амилоидната структура след смилане с натокиназа (Фигура 3). Тези резултати показват, че натокиназата може да разгради и трите различни типове амилоидни фибри.

Оптимизиране на смилането на амилоида от натокиназата. Известно е, че при неутрално и алкално pH (7-12) фибринолитичното действие на натокиназата е стабилно, но при pH под 5, то е променливо (3). За да изследваме ефекта на pH върху разграждането на амилоида от натокиназата, ние проведохме протеолитично смилане на инсулинови фибри в широк интервал от стойности на pH (pH 5-10) при 400С. Както е показано на фигура 4, действието й нараства постепенно с покачването на pH и е максимално при pH 10 от тествания обхват. При pH 5 натокиназата не показа никаква активност.



Температура (°C)

време на смилане (часове)



Фигура 5. Разграждане на инсулинови фибри чрез натокиназа при различни температури между 30 и 600С. Смилането бе проведено в фосфатен буфер, pH 7 и мониторирано чрез ThT байндинг тест. (A) Време за разграждане, мониторирано чрез измерване на останалите амилоидни фибри. (B) Процент на амилоиден разпад при различни температури, изчислен при използване на данните от едночасово смилане. 100% бе дефинирано като интензивност на флуоресценцията на 487 nm от пробата преди третирането й. Стойностите са средната ±SEM за резултатите от два експеримента.

Време (мин.)


Фигура 6. Сравнение на разграждането на Aβ40 фибрите от протеиназа К, натокиназа, субтилизин Carlsberg,трипсин и плазмин. Разграждането беше направено при 370С и pH 7 и мониторирано чрез ThT байндинг тест на всеки 15 минути. 100% бе дефинирано като интензивност на флуоресценцията на контролата преди инкубирането на 487 nm.
Освен това, има съобщение, че фибринолитичната активност на натокиназата постепенно се загубва при температура над 600С (3). Ето защо ние тествахме способността на натокиназата да разгражда амилоида при различни температури и pH 7. Както е показано на фигура 5, при 60 0С инсулиновите фибри се разграж -дат през първите няколко минути, но след това смилането спира, което се дължи вероятно на инактивиране или самосмилане на натокиназата.




Концентрация на натокиназата (μM)


Фигура 7. Зависимост на разпада на Aβ фибрите от концентрацията на натокиназата. Aβ фибрите (44 μM) бяха инкубирани заедно с натокиназа (крайна концентрация на ензима 0,12, 0,18, 0,24, 0,30 или 0,36 μM) на 370C във фосфатен буфер, pH 7.4. Стойностите са средната ±SEM за резултатите от два отделни експеримента.
На 500C се наблюдава бързо начално смилане, последвано от бавно смилане, докато на 400C, началното разграждане не е толкова бързо, но смилането е по-продължително и по-пълно. Процентът на разграждане на амилоида, измерен на 400C и pH 7 с ThT байндинг тест (фигура 5В) е по-нисък от измерения с CD спектроскопия при същите условия (фигура 4В). Ние забелязахме, че интензивността на ThT флуоресценцията е по-голяма при инкубиране на инсулиновите фибри на 400C (данните не са показани). Максимална интензивност на флуоресценцията бе измерена преди инкубирането. Това противоречие може да се дължи на недооценяване на максималната интензивност на флуоресценцията на 400C.

Сравняване на натокиназата с другите протеази. Натокиназата и няколко други серинови протеази бяха тествани по отношение на тяхната способност да смилат Аβ фибрите при 370C и pH 7. Използваните протеази бяха протеиназа К (кератинолитичен ензим, субтилизиноподобна серинова протеаза, използвана в проучванията на прионовите болести), субтилизин Carlsberg, трипсин и плазмин (фибринолитична серинова протеаза). Беше използвана една и съща протеазна концентрация (0,27 μM). Както е показано на фигура 6, при 370C и pH 7, протеиназа К и субтилизин Carlsberg разграждат Аβ фибрите най-бързо. Скоростта на хидролизата беше по-малка при натокиназата и много по-малка при трипсина, докато плазминът не бе ефективен въобще. Въпреки че, с цел да се имитира телесната температура, смилането не бе извършено при оптималната температура за протеиназа К, субтилизин Carlsberg или натокиназата, тяхното разграждащо амилоида действие беше много по-голямо от това на трипсина и плазмина. Tucker и кол. (23) показаха, че плазминът може да разгражда Аβ мономер, както и агрегирани Аβ, но скоростта (0,003 s-1) е 20 пъти по-малка от тази за разграждане на агрегиран фибрин (0,064 s-1) и 160 пъти по-малка от тази за разграждане на Аβ мономер (0,48 s-1). При същите условия на реакцията, в нашето проучване натокиназата показа много по-висока ефикасност за разцепване на амилоида от плазмина. Скоростта на разграждане на Аβ фибри от натокиназата бе 0,015 s-1 при 370C и pH 7,4 (Фиг. 7).

ОБСЪЖДАНЕ

В това проучване ние използвахме три вида приготвени in vitro амилоидни фибри - Аβ амилоидни фибри а, инсулинови амилоидни фибри и huPrP амилоидни фибри (съдържащи прионова последова- телност 108-144), за да изпитаме способността на натокиназата да разгражда амилоида. При първото си



разтваряне в буфер с физиологична концентрация на сол пептидите Aβ40 и huPrP имат произволна спира -ловидна структура, но след няколко дни те претърпя- ват “coil-to-β” структурна конверсия. Нативната структура на инсулина съдържа много α-хеликси, но когато се разтвори в кисела среда и се нагрее на 60 °C настъпва структурна конверсия от α-в β. Структурното преустройство може да бъде потвърдено от появата на негативна елиптичност на 218 nm в CD спектъра, морфологията на фибрите при електронна микроско- пия и флуоресценцията на 487 nm в ThT байндинг теста. Характерната “cross-β” структура може да бъде мониторирана чрез CD спектроскопия. ThT байндинг тестът е най-чувствителният и широко използван метод за откриване и количествено определяне на амилоидните фибри. Предполага се, че ThT се свързва с дългата си ос с оста на амилоидните фибри (24) и че страничните вериги на аминокиселинните остатъци ограничават ротацията на ThT така, че да се увеличи произведената от ThT флуоресценция (21). Амилоид- ният сигнал намалява след третирането на трите раз- лични амилоидни фибри с натокиназа (фигури 1 и 2), което показва, че натокиназата има свойството да разгражда общия амилоид. Тази способност на нато- киназата предполага, че тя може да бъде полезна за лечението на заболяванията, свързани с амилоида. Ензимът кератиназа, който разгражда перата, (Versazyme) и се продуцира от Bacillus licheniformis, може да разгражда предварително загретия прион (25) и може да се използва за инактивиране на приона в месо и костно брашно (26) и обеззаразяване на медицински инструменти (27), но не може да се приема през устатата. Много протеини и пептиди като имуноглобулина с лека верига транстиретин, β2-микроглобулинът, серумният амилоид А протеин, Aβ пептидите и инсулинът могат да образуват амилоидни отлагания в тялото (28). Aβ пептидите могат да преминават от мозъка в кръвта с помощта на протеина с ниска плътност, свързан с рецептора на липопроте- ина и р-гликопротеина (29). Освен това, прионовата болест може да се пренася с кръвопреливане (30), което предполага наличието на прион в кръвта. Амилоидните фибри са неразтворими и не се смилат лесно от протеазите. Откриването на ензим, който разгражда амилоидните фибри и чието приемане през устата е безопасно, може да бъде много полезно за терапията на заболяванията, свързани с амилоида. Натокиназата не само разтваря кръвните съсиреци (9), но разгражда и амилоидните фибри. Нашите проучва- ния върху разграждането на амилоида показаха, че тя е активна при неутрално pH и температурата на тялото. Предишни резултати при плъхове, кучета и хора показват, че натокиназата, приета през устата, може да навлиза в кръвния ток (11, 12), така че тя има потенциал да изчиства амилоидните отлагания от различните части на тялото. Нещо повече, прионовите болести могат да се предават чрез употреба на конта- минирани хирургични инструменти. Натокиназата може да издържа на температура 50°C и да работи дори по-добре при основно pH 10.Това предполага, че тя може да бъде от полза за деконтаминиране на инструменти. Необходими са по-нататъшни проучва- ния при животни, за да се оцени терапевтичния потенциал на натокиназата. Могат да се приготвят различни амилоидни фибри in vitro и да се инжекти- рат на мишки. Натокиназата може да им бъде давана с храна “natto” или като натокиназа или чрез инжек- ти-ране на неин разтвор в тялото. Способността за разграждане на амилоида може да бъде тествана след инкубиране, като се определи останалия амилоид. Нещо повече , тъй като “natto” се приема отдавна от хората, може да се направи епидемиологично проуч- ване върху честотата на болестите, свързани с амилоида сред население редовно консумиращо “natto”.

ЦИТИРАНА ЛИТЕРАТУРА


  1. Ueda, S. Industrial applications of B. subtilis: utilization of soybean as natto, a traditional Japanese food. In Bacillus subtilis: molecular biology and industrial applications; Maruo, B., Yoshikawa, H., Eds.; Elsevier Science B. V.: Amsterdam, the Netherlands, 1989; pp 143-161.

  2. Peng, Y.; Yang, X.; Zhang, Y. Microbial fibrinolytic enzymes: an overview of source, production, properties, and thrombolytic activity in vivo. Appl. Microbiol. Biotechnol. 2005, 69, 126–132.

  3. Sumi, H.; Hamada, H.; Tsushima, H.; Mihara, H.; Muraki, H. A novel fibrinolytic enzyme (nattokinase) in the vegetable cheese Natto; a typical and popular soybean food in the Japanese diet. Experientia 1987, 43, 1110–1111.

  4. Kamata, H.; Yamagata, Y.; Nakamura, T.; Nakajima, T.; Oda, K.; Murao, S.; Ichishima, E. Characterization of the complex between R2-macroglobulin and a serine proteinase from Bacillus natto. Agri. Biol. Chem. 1989, 53, 2695–2702.

  5. Fujita, M.; Nomura, K.; Hong, K.; Ito, Y.; Asada, A.; Nishimuro, S. Purification and characterization of a strong fibrinolytic enzyme (nattokinase) in the vegetable cheese natto, a popular soybean fermented food in Japan. Biochem. Biophys. Res. Commun. 1993, 197, 1340–1347.

  6. Nakamura, T.; Yamagata, Y.; Ichishima, E. Nucleotide sequenceof the subtilisin NAT gene, aprN, of Bacillus subtilis (natto). Biosci., Biotechnol., Biochem. 1992, 56, 1869–1871.

  7. Fujita, M.; Hong, K.; Ito, Y.; Fujii, R.; Kariya, K.; Nishimuro, S.Thrombolytic effect of nattokinase on a chemically induced thrombosis model in rat. Biol. Pharm. Bull. 1995, 18, 1387–1391.

  8. Urano, T.; Ihara, H.; Umemura, K.; Suzuki, Y.; Oike, M.; Akita, S.; Tsukamoto, Y.; Suzuki, I.; Takada, A. The profibrinolytic enzyme subtilisin NAT purified from Bacillus subtilis cleaves and inactivates plasminogen activator inhibitor type 1. J. Biol. Chem. 2001, 276, 24690–24696.

  9. Chang, C. T.; Fan, M. H.; Kuo, F. C.; Sung, H. Y. Potent fibrinolytic enzyme from a mutant of Bacillus subtilis IMR-NK1. J. Agric. Food Chem. 2000, 48, 3210–3216.

  10. Fujita, M.; Hong, K.; Ito, Y.; Misawa, S.; Takeuchi, N.; Kariya, K.; Nishimuro, S. Transport of nattokinase across the rat intestinal tract. Biol. Pharm. Bull. 1995, 18, 1194–1196.

  11. Sumi, H.; Hamada, H.; Nakanishi, K.; Hiratani, H. Enhancement of the fibrinolytic activity in plasma by oral administration of nattokinase. Acta Haematol. 1990, 84, 139–143.

  12. Suzuki, Y.; Kondo, K.; Matsumoto, Y.; Zhao, B. Q.; Otsuguro, K.; Maeda, T.; Tsukamoto, Y.; Urano, T.; Umemura, K. Dietary supplementation of fermented soybean, natto, suppresses intimal thickening and modulates the lysis of mural thrombi after endothelial injury in rat femoral artery. Life Sci. 2003, 73, 1289–1298.

  13. Banerjee, A.; Chisti, Y.; Banerjee, U. C. Streptokinase - a clinically useful thrombolytic agent. Biotechnol. AdV. 2004, 22, 287–307.

  14. Uversky, V. N.; Fink, A. L. Conformational constraints for amyloid fibrillation: the importance of being unfolded. Biochim. Biophys. Acta 2004, 1698, 131–153.

  15. Chen, P. Y.; Lin, C. C.; Chang, Y. T.; Lin, S. C.; Chan, S. I. One O-linked sugar can affect the coil-to-β structural transition of the prion peptide. Proc. Natl. Acad. Sci. U.S.A. 2002, 99, 12633- 12638.



  1. Zhang, H.; Kaneko, K.; Nguyen, J. T.; Livshits, T. L.; Baldwin, M. A.; Cohen, F. E.; James, T. L.; Prusiner, S. B. Conformational transformations in peptides containing two putative R-helices of the prion protein. J. Mol. Biol. 1995, 250, 514–526.

  2. Kuo, L. C.; Cheng, W. Y.; Wu, R. Y.; Huang, C. J.; Lee, K. T. Hydrolysis of black soybean isoflavone glycosides by Bacillus subtilis natto. Appl. Microbiol. Biotechnol. 2006, 73, 314–320.

  3. Kuo, L. C.; Lee, K. T. Cloning, expression, and characterization of two β-glucosidase from isoflavone glucoside-hydrolyzing Bacillus subtilis natto. J. Agric. Food Chem. 2008, 56, 119–125.

  4. Friberger, P.; Knos, M.; Gustavsson, S.; Aurell, L.; Claeson, G.Methods for determination of plasmin, antiplasmin and plasminogen by means of substrate S-2251. Haemostasis 1978, 7, 138–145.

  5. Chang, E. S.; Liao, T. Y.; Lim, T. S.; Fann, W.; Chen, R. P. A new amyloid-like _-aggregate with most of the amyloid characteristics except fibril morphology. J. Mol. Biol. 2008, 10.1016/j.jmb.2008.11.009.

  6. Groenning, M.; Norrman, M.; Flink, J. M.; van de Weert, M.; Bukrinsky, J. T.; Schluckebier, G.; Frokjaer, S. Binding mode of Thioflavin T in insulin amyloid fibrils. J. Struct. Biol. 2007, 159, 483–497.

  7. Nielsen, L.; Khurana, R.; Coats, A.; Frokjaer, S.; Brange, J.; Vyas, S.; Uversky, V. N.; Fink, A. L. Effect of environmental factors on the kinetics of insulin fibril formation: elucidation of the molecular mechanism. Biochemistry 2001, 40, 6036–6046.

  8. Tucker, H. M.; Kihiko, M.; Caldwell, J. N.; Wright, S.; Kawarabayashi, T.; Price, D.; Walker, D.; Scheff, S.; McGillis, J. P.; Rydel, R. E.; Estus, S. The plasmin system is induced by and degrades amyloid-beta aggregates. J. Neurosci. 2000, 20, 3937– 3946.

  9. Krebs, M. R. H.; Bromley, E. H. C.; Donald, A. M. The binding of thioflavin-T to amyloid fibrils: localisation and implications. J. Struct. Biol. 2005, 149, 30–37.

  10. Langeveld, J. P. M.; Wang, J. J.; Van de Wiel, D. F. M.; Shih, G. C.; Garssen, G. J.; Bossers, A.; Shih, J. C. H. Enzymatic degradation of prion protein in brain stem from infected cattle and sheep. J. Infect. Dis. 2003, 188, 1782–1789.

  11. Coll, B. A.; Garcia, R. A.; Marmer, W. N. Diffusion of protease into meat & bone meal for solubility improvement and potential inactivation of the BSE prion. PLoS ONE 2007, 2, e245.

  12. Gupta, R.; Ramnani, P. Microbial keratinases and their prospective applications: an overview. Appl. Microbiol. Biotechnol. 2006, 70, 21–33.

  13. Chiti, F.; Dobson, C. M. Protein misfolding, functional amyloid, and human disease. Annu. ReV. Biochem. 2006, 75, 333–366.

  14. Wang, Y. J.; Zhou, H. D.; Zhou, X. F. Clearance of amyloid beta in Alzheimer’s disease: progress, problems and perspectives. Drug DiscoVery Today 2006, 11, 931–938.

  15. Hunter, N.; Foster, J.; Chong, A.; McCutcheon, S.; Parnham, D.; Eaton, S.; MacKenzie, C.; Houston, F. Transmission of prion diseases by blood transfusion. J. Gen. Virol. 2002, 83, 2897–2905.



Статията е получена за разглеждане на 2 октомври 2008г. Поправеният ръкопис е получен на 23 ноември 2008г. Одобрена на 23 ноември 2008г.

JF803072R








Каталог: 4 2 -> 000 -> 000 -> 13f
000 -> Отчет за дейността на сдружениeто за воден туризъм
000 -> Езикът на тялото
000 -> Медицински свойства на веществата в гъбите висши базидиомицети: актуални перспективи (преглед) 1
000 -> Agaricus blazei Cordyceps sinensis
000 -> Апликационна форма за всеки клиничен случай се попълва отделна апликационна форма
000 -> 1336 София, Люлин 610/Г/71
13f -> Диетичният прием на Витамин K2 (Menaquinone) намалява риска от коронарна болест на сърцето: Ротердамското проучване


Поделитесь с Вашими друзьями:




База данных защищена авторским правом ©obuch.info 2020
отнасят до администрацията

    Начална страница